Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
rhCNTF | GE13.1 | 50μg | 24 months | 2200 |
GE13.2 | 100μg | 4500 |
Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
rhCNTF | GE13.1 | 50μg | 24 months | 2200 |
GE13.2 | 100μg | 4500 |
Ciliary neurotrophic factor (CNTF) is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. It was initially identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. The protein is also a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. In addition, CNTF is useful for treatment of motor neuron disease, and it could reduce food intake without causing hunger or stress.
储存分类代码 | WGK | 闪点(F) |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
闪点(C) | 个人防护装备 | |
Not Applicable | Dust mask type N95, Eyeshields, Gloves |
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Gene ID
Catalog Number
GE13.1/GE13.2
Unit Size
50μg/100μg
Source
E. coli
Molecular Weight
Approximately 22.9 kDa, a single non-glycosylated polypeptide chain containing 200 amino acids
Purity (HPLC)
>97%
Purity (SDS-PAGE)
>97%
Biological Activity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.03-0.15 μg/mL, corresponding to a specific activity of ≥ 6.7 × 103 Units/mg.
Host Cell DNA Residue
<0.02 ng/μg of protein tested by DNA Fluorescent Staining method.
Host Cell Protein Residue
<0.5 ng/μg of protein tested by ELISA
Formulation
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Sterility
Negative
Endotoxin
<0.01 EU/μg as determined by LAL gel-clot method
Mycoplasma
Negative
Shipping
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL
Reconstitution Stability & Storage
Please read our USER MANUAL and FAQs
Specs
DATA
FAQs
Sterile Filtered White lyophilized (freeze-dried) powder.
Ciliary neurotrophic factor (CNTF) is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. It was initially identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. The protein is also a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. In addition, CNTF is useful for treatment of motor neuron disease, and it could reduce food intake without causing hunger or stress.
GE13.1/GE13.2
50μg/100μg
E. coli
Approximately 22.9 kDa, a single non-glycosylated polypeptide chain containing 200 amino acids
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPT
EGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
>97%
>97%
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.03-0.15 μg/mL, corresponding to a specific activity of ≥ 6.7 × 103 Units/mg.
<0.02 ng/μg of protein tested by DNA Fluorescent Staining method.
<0.5 ng/μg of protein tested by ELISA.
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Negative
<0.01EU/μg as determined by LAL gel-clot method.
Negative
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL
Please read our USER MANUAL and FAQs