Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
BETAGENE rhIFN-γ | GE04.1 | 50μg | 24 months | 450 |
GE04.2 | 100μg | 600 |
Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
rhIFN-γ | GE04.1 | 100μg | 24 months | 450 |
GE04.2 | 200μg | 600 |
Interferon-gamma (IFN-γ), also known as Type II interferon or immune interferon, is a dimerized soluble cytokine that is critical for innate and adaptive immunity against viral, some bacterial and protozoal infections. It is produced primarily by CD4 and CD8 T lymphocytes as well as natural killer (NK) and natural killer T(NKT) cells. The primary role for IFN-γ is the activation of macrophages to increase phagocytosis, tumoricidal properties, and intracellular killing of pathogens. IFN-γ also increases expression of MHC antigens by macrophages and this facilitates antigen presentation to T cells. The recombinant Interferon-gamma s a 16.9 kDa protein consisting of 144 amino acid residues.
Storage Class Code | WGK | 闪点(F) |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
Flash Point(C) | Personal Protection | |
Not Applicable | Dust mask type N95, Eyeshields, Gloves |
Specs
Data
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 15978 |
AA Sequence | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
Host | E.Coli |
Molecule Weight | Approximately 16.9 kDa, 144 amino acids |
Biological Activity | Fully biologically active when compared to standard substance. The ED50 as measured in anti-viral assays using human HeLa cells infected with encephalomyocarditis (EMC) virus is 0.15-0.80 ng/mL, corresponding to a specific activity of 2 x 104 IU/μg. |
Purity | >98% by SDS-PAGE or HPLC |
Formulation | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4, with 5% Trehalose, BSA-free. |
Host Cell DNA | < 0.02 ng/μg of protein |
Host Cell Protein | < 0.05% when tested by ELISA |
Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Stability&Storage |
For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. At least 24 months from date of receipt, ≤-20℃ as supplied; 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution; 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended. |
Description |
Interferon-gamma (IFN-γ), also known as Type II interferon or immune interferon, is a dimerized soluble cytokine that is critical for innate and adaptive immunity against viral, some bacterial and protozoal infections. It is produced primarily by CD4 and CD8 T lymphocytes as well as natural killer (NK) and natural killer T(NKT) cells. The primary role for IFN-γ is the activation of macrophages to increase phagocytosis, tumoricidal properties, and intracellular killing of pathogens. IFN-γ also increases expression of MHC antigens by macrophages and this facilitates antigen presentation to T cells. The recombinant Interferon-gamma s a 16.9 kDa protein consisting of 144 amino acid residues. |
Data |