Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
BETAGENE rhIL-7 | GE06.1 | 50μg | 24 months | 3600 |
GE06.2 | 100μg | 5800 |
Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
rhIL-7 | GE06.1 | 50μg | 24 months | 3600 |
GE06.2 | 100μg | 5800 |
IL-7 (interleukin-7) is a 25 kDa cytokine of the hemopoietin family that plays important roles in lymphocyte differentiation, proliferation, and survival. Human IL‑7 cDNA encodes 177 amino acids (aa) that include a 25 aa signal peptide. Human IL-7 shares approximately 60-63% aa sequence identity with mouse, rat, canine and feline IL-7, and 72-76% with equine, bovine, ovine, and porcine IL-7. Human and mouse IL-7 exhibit cross-species activity.
IL-7 is produced by a wide variety of cells in primary and secondary lymphoid tissues, including stromal epithelial cells of the thymus, bone marrow, and intestines. Circulating IL-7 is limiting in healthy animals, but increases during lymphopenia. IL-7 signals through a complex of the IL-7 Receptor alpha subunit (IL-7 R alpha, also known as CD127) with the common gamma chain ( gamma c). The gamma c is also a subunit of the receptors for IL-2, -4, -9, -15, and -21.
Storage Class Code | WGK | Flash Point(F) |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
Flash Point(C) | Personal Protection | |
Not Applicable | Dust mask type N95, Eyeshields, Gloves |
Specs
Data
Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
Gene ID | 3574 |
AA Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Host | E.Coli |
Molecule Weight | Approximately 17.5 kDa, 153 amino acids |
Biological Activity | Fully biologically active when compared to standard substance. The ED50 was determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is ≤ 0.5 ng/mL, corresponding to a specific activity of ≥ 2 x 106 units/mg. |
Purity | >97% by SDS-PAGE or HPLC |
Formulation | Lyophilized from a 0.2μm filtered solution in PBS pH7.4. |
Host Cell DNA | < 0.02 ng/μg of protein |
Host Cell Protein | < 0.05% when tested by ELISA |
Mycoplasma | Negative |
Endotoxin (LAL) | < 0.01 EU/μg |
Sterility | Negative |
Reconstitution | Before use this product, please read the direction below carefully. 1. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. 3. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Stability&Storage | For long term storage, the product should be stored ≤-20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 1. At least 24 months from date of receipt, ≤-20 as supplied; 2. 1 month, 2 to 8 °C under sterile conditions after reconstitution; 3. 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended. |
Description |
IL-7 (interleukin-7) is a 25 kDa cytokine of the hemopoietin family that plays important roles in lymphocyte differentiation, proliferation, and survival. Human IL‑7 cDNA encodes 177 amino acids (aa) that include a 25 aa signal peptide. Human IL-7 shares approximately 60-63% aa sequence identity with mouse, rat, canine and feline IL-7, and 72-76% with equine, bovine, ovine, and porcine IL-7. Human and mouse IL-7 exhibit cross-species activity. IL-7 is produced by a wide variety of cells in primary and secondary lymphoid tissues, including stromal epithelial cells of the thymus, bone marrow, and intestines. Circulating IL-7 is limiting in healthy animals, but increases during lymphopenia. IL-7 signals through a complex of the IL-7 Receptor alpha subunit (IL-7 R alpha, also known as CD127) with the common gamma chain ( gamma c). The gamma c is also a subunit of the receptors for IL-2, -4, -9, -15, and -21. |
Data |