Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
BETAGENE rhIL-18 | GE10.1 | 50μg | 24 months | 1800 |
GE10.2 | 100μg | 2800 |
Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
rhIL-18 | GE10.1 | 50μg | 24 months | 1800 |
GE10.2 | 100μg | 2800 |
Interleukin-18 (IL-18) is a proinflammatory cytokine in the IL-1 family that exerts distinct immune effects depending on the local cytokine environment. It is expressed as a 24 kDa precursor by endothelial and epithelial cells, keratinocytes, gamma δ T cells, and phagocytes. The precursor is activated intracellularly by Caspase-1 mediated proteolysis to release the 17 kDa mature cytokine. The precursor can also be released by necrotic cells for extracellular cleavage by multiple proteases. IL-18 activation is induced by infection or tissue damage and contributes to disease pathology in chronic inflammation. IL-18 binds to the widely expressedIL-18 R alpha which recruits IL-18 R beta to form the signaling receptor complex. Its bioactivity is negatively regulated by interactions with IL-18 binding proteins and virally encoded IL-18BP homologs. In the presence of IL-12 or IL-15, IL-18 enhances anti-viral Th1 immune responses by inducing IFN-gamma production and the cytolytic activity of CD8+ T cells and NK cells. In the absence of IL-12 or IL-15, however, IL-18 promotes production of the Th2 cytokines IL-4 and IL-13 by CD4+ T cells and basophils. In the presence of IL-1β or IL-23, IL-18 induces the antigen-independent production of IL-17 by gamma δ T cells and CD4+ T cells. IL-18 also promotes myeloid dendritic cell maturation and triggers neutrophil respiratory burst. In cancer, IL-18 exhibits diverse activities including enhancing anti-tumor immunity, inhibiting or promoting angiogenesis, and promoting tumor cell metastasis. Mature human IL-18 shares approximately 63% amino acid sequence identity with mouse and rat IL-18. Alternative splicing in human ovarian cancer generates an isoform that is resistant to Caspase-1 activation. A cell surface form can be expressed on M-CSF induced macrophages and released in response to bacterial endotoxin. |
储存分类代码 | WGK | 闪点(F) |
13 - Non Combustible Solids | WGK 3 | Not Applicable |
闪点(C) | 个人防护装备 | |
Not Applicable | dust mask type N95 (US), Eyeshields, Gloves |
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder
Gene ID
Catalog Number
GE10.1/GE10.2
Unit Size
50μg/100μg
Source
E. coli
Molecular Weight
Approximately 18.2 kDa, a single non-glycosylated polypeptide chain containing 157 amino acids.
Purity (HPLC)
>95%
Purity (SDS-PAGE)
>98%
Biological Activity
Measured by its ability to induce IFN-γ secretion by KG‑1 human acute myelogenous leukemia cells. The ED50 is approximately 1.5 - 15 ng/mL, corresponding to a specific activity of ≥ 3.0 × 106 Units/mg.
Host Cell DNA Residue
<0.02 ng/μg of protein tested by DNA Fluorescent Staining method
Host Cell Protein Residue
<0.5 ng/μg of protein tested by ELISA
Formulation
Lyophilized from a 0.2 μm filtered solution in PBS, 0.02 % Tween-20, pH 7.0.
Sterility
Negative
Endotoxin
<0.01 EU/μg as determined by LAL gel-clot method
Mycoplasma
Negative
Shipping
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL
Reconstitution Stability & Storage
Please read our USER MANUAL and FAQs
Specs
DATA
FAQs
Sterile Filtered White lyophilized (freeze-dried) powder.
Interleukin-18 (IL-18) is a proinflammatory cytokine in the IL-1 family that exerts distinct immune effects depending on the local cytokine environment. It is expressed as a 24 kDa precursor by endothelial and epithelial cells, keratinocytes, gamma δ T cells, and phagocytes. The precursor is activated intracellularly by Caspase-1 mediated proteolysis to release the 17 kDa mature cytokine. The precursor can also be released by necrotic cells for extracellular cleavage by multiple proteases.
GE10.1/GE10.2
50μg/100μg
E. coli
Approximately 18.2 kDa, a single non-glycosylated polypeptide chain containing 157 amino acids.
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR
SVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED
>95%
>98%
Measured by its ability to induce IFN-γ secretion by KG‑1 human acute myelogenous leukemia cells. The ED50 is approximately 1.5 - 15 ng/mL, corresponding to a specific activity of ≥ 3.0 × 10^6 Units/mg.
<0.02 ng/μg of protein tested by DNA Fluorescent Staining method.
<0.5 ng/μg of protein tested by ELISA.
Lyophilized from a 0.2 μm filtered solution in PBS, 0.02 % Tween-20, pH 7.0.
Negative
<0.01EU/μg as determined by LAL gel-clot method.
Negative
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL
Please read our USER MANUAL and FAQs.