Product | Catalog No. | Specification | Shelf life | Price |
---|---|---|---|---|
BETAGENE rhbFGF | GE02.1 | 50μg | 24 months | 1000 |
GE02.2 | 100μg | 1800 |
Product | CAT. No. | Volumn | Shelf life | Price |
---|---|---|---|---|
rhIL-2 | GE05.1 | 100μg | 24 months | 450 |
GE05.2 | 200μg | 600 |
bFGF is a growth factor and signaling protein encoded by the FGF2 gene. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. In normal tissue, bFGF is present in basement membranes and in the subendothelial extracellular matrix of blood vessels. bFGF is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells.
储存分类代码 | WGK | 闪点(F) |
11 - Combustible Solids | WGK 3 | Not Applicable |
闪点(C) | 个人防护装备 | |
Not Applicable | Dust mask type N95, Eyeshields, Gloves |
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder
Gene ID
Catalog Number
GE02.1/GE02.2
Unit Size
50μg/100μg
Source
E. coli
Molecular Weight
Approximately 16.5 kDa, 147 amino acids
Purity (HPLC)
>96%
Purity (SDS-PAGE)
>96%
Biological Activity
The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is <0.05 ng/mL, corresponding to a specific activity of ≥ 2.0 × 107 Units/mg.
Host Cell DNA Residue
<0.02 ng/μg of protein tested by DNA Fluorescent Staining method
Host Cell Protein Residue
<0.5 ng/μg of protein tested by ELISA
Formulation
Lyophilized from a 0.2μm filtered solution concentrated solution in 20mM Tris,150mM NaCl, 5% trehalose, 0.2‰ TWEEN-20, pH7.6
Sterility
Negative
Endotoxin
<0.01 EU/μg as determined by LAL gel-clot method
Mycoplasma
Negative
Shipping
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended in our USER MANUAL
Reconstitution Stability & Storage
Please see read USER MANUAL and FAQs
Specs
DATA
FAQs
Sterile Filtered White lyophilized (freeze-dried) powder.
bFGF is a growth factor and signaling protein encoded by the FGF2 gene. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. In normal tissue, bFGF is present in basement membranes and in the subendothelial extracellular matrix of blood vessels. bFGF is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells.
GE02.1/GE02.2
50μg/100μg
E. coli
Approximately 16.5 kDa, 147 amino acids
MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES
NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
>96%
>96%
The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is <0.05 ng/mL, corresponding to a specific activity of ≥ 2.0 × 10^7 Units/mg.
<0.02 ng/μg of protein tested by DNA Fluorescent Staining method.
<0.5 ng/μg of protein tested by ELISA.
Lyophilized from a 0.2μm filtered solution concentrated solution in 20mM Tris,150mM NaCl, 5% trehalose, 0.2‰ TWEEN-20, pH7.6
Negative
<0.01EU/μg as determined by LAL gel-clot method.
Negative